PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676732798
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family HB-other
Protein Properties Length: 965aa    MW: 106431 Da    PI: 9.2825
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676732798genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.29e-0667123157
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                +r+R  ++++ ++ L+++F+ +  +s++e +e+++  g++ +q++ +F  ++++ +k
  676732798  67 KRPRDLLNPKAVKYLQAVFAIKDSISKKESREISALFGISVAQIRDFFVTQKTRVRK 123
                799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.50764124IPR001356Homeobox domain
SMARTSM003899.1E-566128IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.7E-467126IPR009057Homeodomain-like
SuperFamilySSF466891.15E-567131IPR009057Homeodomain-like
CDDcd000862.76E-467124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 965 aa     Download sequence    Send to blast
MDDAFKEEIE IGSSVESLME LLNSQKQLFH SQIDQLQDVV VTQCKLTGVN PLAQEMAAGA  60
LSIKIGKRPR DLLNPKAVKY LQAVFAIKDS ISKKESREIS ALFGISVAQI RDFFVTQKTR  120
VRKQVRVSRE KLMMSSALAL QGDGVPEKNN AIPLFDPVPL NSIGPEASSI SWGEGVTVAL  180
PPKEEVPQED LPPDISDSDK YFVENIFSLL RKEETFLGQV KLMEWIMQIQ DSSVLIWFLS  240
KGGVLILTTW LSQAATEEQT SVLLLILKVL CHLPLHKASP ENMSAILQSV NGLRFYRTSG  300
VISEKHKCCV AFINVKVRVV ISSISLSDLK IRHIKQGESI AEIMGDSSNP EDILSISNGR  360
SENGRRSKSS QGPKLLLTSA DDSTRKHMLG STPSSDNKER RKVQMVEQPG QKAAGRSPQT  420
VRIGTSSRSR PMSADDIQKA KMRALYMHSK NSKKDPLSSA IGDSKTVIPE KPLALQSAKD  480
SPPSENNEAK TEDTPESSSV QPVNSPAVNL PVQPVNSPAV NLPFQPVNSP AVNVPVQPVN  540
SPAVNVPVQP VSSPAVKMSG QADEFRKPST PPKIISNKVG VLLKMSPQTI LKNCKRKQIN  600
WHVPPGMELD ELWRVAAGGN SKEADVQKNR NRREKEIAYH SLQTIPLNPK EPWDREMDYD  660
DSLTPDIPSQ QPPEESITEP QESLYDRRTA AGAATSSSSQ SSSMEPDFEL LAALLKNPDL  720
LYALTSGNPG NLAGPDMVKL LDVIKTGASN SSSISYKKVE EKVEVSLPSP TPSTNPGMSG  780
WGQEAIRNPF SRQSQVGAAV ARMSTQLPVA SMQWQSSNEQ SIPRHAPSAY NSHTLAHTER  840
QQQQQPMQSR LLHQSQHLHQ QQQPILTNSY AVRESVGQMG TATSASWRSQ QSQNSYYTPQ  900
ANGIASASSY QVSEQYMSNN PGFESWSPDH SPSRNHPNMR GQQQQQPSRK HDSSHPYWNQ  960
NRRWR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002872830.10.0hypothetical protein ARALYDRAFT_911958
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLD7M3G50.0D7M3G5_ARALL; Putative uncharacterized protein
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein